Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HS6ST3 Rabbit Polyclonal Antibody (HRP)

HS6ST3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HS6ST-3

UniProt

Q8IZP7

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human HS6ST3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TKQLEHQRDRQKRREERRLQREHRDHQWPKEDGAAEGTVTEDYNSQVVRW

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_703157

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RFC3 (Replication Factor C Subunit 3, Activator 1 Subunit 3, Replication Factor C 38kD Subunit, RF-C 38kD Subunit, RFC38, Activator 1 38kD Subunit, A1 38kD Subunit, MGC5276)
132490 100 µg

RFC3 (Replication Factor C Subunit 3, Activator 1 Subunit 3, Replication Factor C 38kD Subunit, RF-C 38kD Subunit, RFC38, Activator 1 38kD Subunit, A1 38kD Subunit, MGC5276)

Sign In for Pricing
View Details
Anti-CAPZA1 Antibody
A07665 100 µL

Anti-CAPZA1 Antibody

Sign In for Pricing
View Details
IL17D Recombinant Protein N-His Tag Lyophilized 20UG
IMSIL17DRNHISLY20UG 20 µg

IL17D Recombinant Protein N-His Tag Lyophilized 20UG

Sign In for Pricing
View Details
CSPG5 (CALEB, NGC, Chondroitin Sulfate Proteoglycan 5, Acidic Leucine-rich EGF-like Domain-containing Brain Protein, Neuroglycan C, MGC44034) (MaxLight 490)
MBS6200317-01 0.1 mL

CSPG5 (CALEB, NGC, Chondroitin Sulfate Proteoglycan 5, Acidic Leucine-rich EGF-like Domain-containing Brain Protein, Neuroglycan C, MGC44034) (MaxLight 490)

Sign In for Pricing
View Details
CSPG5 (CALEB, NGC, Chondroitin Sulfate Proteoglycan 5, Acidic Leucine-rich EGF-like Domain-containing Brain Protein, Neuroglycan C, MGC44034) (MaxLight 490)
MBS6200317-02 5x 0.1 mL

CSPG5 (CALEB, NGC, Chondroitin Sulfate Proteoglycan 5, Acidic Leucine-rich EGF-like Domain-containing Brain Protein, Neuroglycan C, MGC44034) (MaxLight 490)

Sign In for Pricing
View Details
Transmembrane protein 186 (TMEM186) Bovine ELISA Kit
H8365 96 Tests

Transmembrane protein 186 (TMEM186) Bovine ELISA Kit

Sign In for Pricing
View Details