Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTA5 Rabbit Polyclonal Antibody (FITC)

GSTA5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q7RTV2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human GSTA5

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QPEERDAKTALVKEKIKNRYFPAFEKVLKSHRQDYLVGNKLSWADIHLVE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_714543

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat IFNgamma
BL10729_R 0.1 mg

Recombinant Rat IFNgamma

Sign In for Pricing
View Details
Rabbit BRD4 Recombinant Monoclonal Antibody
orb1519995 100 ug (BSA-free)

Rabbit BRD4 Recombinant Monoclonal Antibody

Sign In for Pricing
View Details
Sodium channel protein type 1 subunit α (SCN1A) Human ELISA Kit
H1455 96 Tests

Sodium channel protein type 1 subunit α (SCN1A) Human ELISA Kit

Sign In for Pricing
View Details
TMED6 (NM_144676) Human Recombinant Protein
PROTQ8WW62 20 µg

TMED6 (NM_144676) Human Recombinant Protein

Sign In for Pricing
View Details
Hamster C-C Chemokine Receptor Type 4 (CCR4) ELISA Kit
MBS109230-01 48 Well

Hamster C-C Chemokine Receptor Type 4 (CCR4) ELISA Kit

Sign In for Pricing
View Details
Hamster C-C Chemokine Receptor Type 4 (CCR4) ELISA Kit
MBS109230-02 96 Well

Hamster C-C Chemokine Receptor Type 4 (CCR4) ELISA Kit

Sign In for Pricing
View Details