Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STKLD1 Rabbit Polyclonal Antibody (HRP)

STKLD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Sk521, SgK071, C9orf96

UniProt

Q8NE28

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C9orf96

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AFKVVVQEEGGSGLSLIKETYQLHRDDPEVVENVGMLLVHLASYEEILPE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Rat

Tested Applications

WB

NCBI Accession Number

NP_714921

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Reep2 Pre-designed siRNA Set B
SI111846B 1 Each

Mouse Reep2 Pre-designed siRNA Set B

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)
MBS2058539-01 0.1 mL

HRP-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)
MBS2058539-02 0.2 mL

HRP-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)
MBS2058539-03 0.5 mL

HRP-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)
MBS2058539-04 1 mL

HRP-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)
MBS2058539-05 5 mL

HRP-Linked Polyclonal Antibody to Signal Transducer And Activator Of Transcription 3 (STAT3)

Sign In for Pricing
View Details