Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Upp2 Rabbit Polyclonal Antibody (HRP)

Upp2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

UP, UP2, UPA, UDRP, UPASE2, AI266885, UDRPASE2, 1700124F02Rik

UniProt

Q8CGR7

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SREIPNVPTLIGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAYRAG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_083968

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

ILF3 (NM_012218) Human Over-expression Lysate
LY415895 100 µg

ILF3 (NM_012218) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Rat Heat shock cognate 71 kDa protein 2
MBS1242642-01 0.02 mg (E-Coli)

Recombinant Rat Heat shock cognate 71 kDa protein 2

Sign In for Pricing
View Details
Recombinant Rat Heat shock cognate 71 kDa protein 2
MBS1242642-02 0.1 mg (E-Coli)

Recombinant Rat Heat shock cognate 71 kDa protein 2

Sign In for Pricing
View Details
Recombinant Rat Heat shock cognate 71 kDa protein 2
MBS1242642-03 0.02 mg (Yeast)

Recombinant Rat Heat shock cognate 71 kDa protein 2

Sign In for Pricing
View Details
Recombinant Rat Heat shock cognate 71 kDa protein 2
MBS1242642-04 0.1 mg (Yeast)

Recombinant Rat Heat shock cognate 71 kDa protein 2

Sign In for Pricing
View Details
Recombinant Rat Heat shock cognate 71 kDa protein 2
MBS1242642-05 0.02 mg (Baculovirus)

Recombinant Rat Heat shock cognate 71 kDa protein 2

Sign In for Pricing
View Details