Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B4GALNT3 Rabbit Polyclonal Antibody (HRP)

B4GALNT3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B4GalNac-T3, FLJ16224, FLJ40362

UniProt

Q6L9W6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human B4GALNT3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NEEGTDHVEVAWRRNDPGAKFTIIDSLSLSLFTNETFLQMDEVGHIPQTA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

115kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_775864

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Thyroid gland
CS618115 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Sign In for Pricing
View Details
Dusp15 (NM_001108598) Rat Tagged Lenti ORF Clone
RR212872L3 10 µg

Dusp15 (NM_001108598) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Ckm 3'UTR Lenti-reporter-Luc Vector
16220086 1.0 µg

Ckm 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
C19orf54 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-9684R-BF555 100 µL

C19orf54 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
PPOX (Protoporphyrinogen Oxidase, MGC8485, PPO, V290M, VP) (MaxLight 490)
250383-ML490 100 µL

PPOX (Protoporphyrinogen Oxidase, MGC8485, PPO, V290M, VP) (MaxLight 490)

Sign In for Pricing
View Details
Human Neuregulin 4 (NRG4) ELISA Kit
RDR-NRG4-Hu-48Tests 48 Tests

Human Neuregulin 4 (NRG4) ELISA Kit

Sign In for Pricing
View Details