Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C3orf64 Rabbit Polyclonal Antibody (HRP)

C3orf64 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AOS4, AER61, EOGT1, C3orf64

UniProt

Q5NDL2

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human C3orf64

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_775925

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Usp54 Mouse Gene Knockout Kit (CRISPR)
KN518812 1 Kit

Usp54 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,3-O-Bis(triisopropylsilyl) Glycerol
TRC-T296350-25G 25 g

1,3-O-Bis(triisopropylsilyl) Glycerol

Sign In for Pricing
View Details
Srsf10 Mouse Gene Knockout Kit (CRISPR)
KN516741 1 Kit

Srsf10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Arid5b Mouse Gene Knockout Kit (CRISPR)
KN501556 1 Kit

Arid5b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MCAM / MUC18 / Mucin 18 / CD146 (MCAM/1101), CF740 conjugate, 0.1mg/mL
BNC741101-100 1x 100 µL

MCAM / MUC18 / Mucin 18 / CD146 (MCAM/1101), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Halofantrine Hydrochloride
TRC-H102400-5MG 5 mg

Halofantrine Hydrochloride

Sign In for Pricing
View Details