Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TENT2 Rabbit Polyclonal Antibody (Biotin)

TENT2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Papd4

UniProt

Q5U315

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: YICVEEPFDGTNTARAVHEKQKFDMIKDQFLKSWQRLKNKRDLNSVLPLR

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001008373

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable CtpA-like serine protease (SSP1319)
MBS7040677-01 0.02 mg

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable CtpA-like serine protease (SSP1319)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable CtpA-like serine protease (SSP1319)
MBS7040677-02 0.1 mg

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable CtpA-like serine protease (SSP1319)

Sign In for Pricing
View Details
Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable CtpA-like serine protease (SSP1319)
MBS7040677-03 5x 0.1 mg

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable CtpA-like serine protease (SSP1319)

Sign In for Pricing
View Details
Lentiviral human TSPYL6 sgRNA gene knockout kit - Lentiviral human TSPYL6 sgRNA gene knockout kit (25)
GTR15399900 1 Vial

Lentiviral human TSPYL6 sgRNA gene knockout kit - Lentiviral human TSPYL6 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
PCMV-GST-UCHL1-Neo Plasmid
PVT77498 2 µg

PCMV-GST-UCHL1-Neo Plasmid

Sign In for Pricing
View Details
KLHL8 (Kelch-like 8 (Drosophila), FLJ46304, KIAA1378)
588500 50 µg

KLHL8 (Kelch-like 8 (Drosophila), FLJ46304, KIAA1378)

Sign In for Pricing
View Details