Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGT3A2 Rabbit Polyclonal Antibody (FITC)

UGT3A2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC119426, MGC119429

UniProt

Q3SY77

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UGT3A2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RYKSAAVAASVILRSHPLSPTQRLVGWIDHVLQTGGATHLKPYVFQQPWH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_777574

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse 1700001P01Rik shRNA (UAS) - Lentiviral mouse 1700001P01Rik shRNA (UAS, GFP) (100)
GTR15274605 1 Vial

Lentiviral mouse 1700001P01Rik shRNA (UAS) - Lentiviral mouse 1700001P01Rik shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Antibody against Streptococcus agalactiae B for Ib, II (and fish)
MBS478255-01 1 mg

Antibody against Streptococcus agalactiae B for Ib, II (and fish)

Sign In for Pricing
View Details
Antibody against Streptococcus agalactiae B for Ib, II (and fish)
MBS478255-02 2 mg

Antibody against Streptococcus agalactiae B for Ib, II (and fish)

Sign In for Pricing
View Details
Antibody against Streptococcus agalactiae B for Ib, II (and fish)
MBS478255-03 5 mg

Antibody against Streptococcus agalactiae B for Ib, II (and fish)

Sign In for Pricing
View Details
Antibody against Streptococcus agalactiae B for Ib, II (and fish)
MBS478255-04 10 mg

Antibody against Streptococcus agalactiae B for Ib, II (and fish)

Sign In for Pricing
View Details
Goat Anti-Human IgA - Cy3
BS22092-01 100 µL

Goat Anti-Human IgA - Cy3

Sign In for Pricing
View Details