Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGT3A2 Rabbit Polyclonal Antibody (FITC)

UGT3A2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

MGC119426, MGC119429

UniProt

Q3SY77

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human UGT3A2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RYKSAAVAASVILRSHPLSPTQRLVGWIDHVLQTGGATHLKPYVFQQPWH

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human

Tested Applications

WB

NCBI Accession Number

NP_777574

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCC3, ID (ABCC3, CMOAT2, MLP2, MRP3, Canalicular multispecific organic anion transporter 2, ATP-binding cassette sub-family C member 3, Multi-specific organic anion transporter D, Multidrug resistance-associated protein 3) (MaxLight 750) discontinued
031477-ML750 100 µL

ABCC3, ID (ABCC3, CMOAT2, MLP2, MRP3, Canalicular multispecific organic anion transporter 2, ATP-binding cassette sub-family C member 3, Multi-specific organic anion transporter D, Multidrug resistance-associated protein 3) (MaxLight 750) discontinued

Sign In for Pricing
View Details
MX1 + MX2 Rabbit Polyclonal Antibody (PerCP)
orb2555063 100 µL

MX1 + MX2 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
AARSD1 Protein Vector (Human) (pPM-N-D-C-HA)
PV318592 500 ng

AARSD1 Protein Vector (Human) (pPM-N-D-C-HA)

Sign In for Pricing
View Details
Anti-PPT1 Antibody Picoband® (monoclonal, 10F3), PE Conjugate
M02690-PE 100 µg/Vial

Anti-PPT1 Antibody Picoband® (monoclonal, 10F3), PE Conjugate

Sign In for Pricing
View Details
SAPK4 Antibody
orb1334026 100 µg

SAPK4 Antibody

Sign In for Pricing
View Details
Human TDRD5 Protein Lysate
MBS8428394-01 0.02 mg

Human TDRD5 Protein Lysate

Sign In for Pricing
View Details