Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Sult1c2 Rabbit Polyclonal Antibody (HRP)

Sult1c2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ST1C2, sultK1

UniProt

Q9WUW8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KCQRTIIQHRHPFIEWARPPQPSGVDKANAMPAPRILRTHLPTQLLPPSF

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_598231

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trem2 Rat Pre-designed siRNA Set A
HY-RS22957 1 Set

Trem2 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
MSI2 Human shRNA Lentiviral Particle (Locus ID 124540)
TL303128V 500 µL Each

MSI2 Human shRNA Lentiviral Particle (Locus ID 124540)

Sign In for Pricing
View Details
Recombinant Azospirillum brasilense Type-2 restriction enzyme AbrI (abrIR)
MBS1217285-01 0.02 mg (E-Coli)

Recombinant Azospirillum brasilense Type-2 restriction enzyme AbrI (abrIR)

Sign In for Pricing
View Details
Recombinant Azospirillum brasilense Type-2 restriction enzyme AbrI (abrIR)
MBS1217285-02 0.1 mg (E-Coli)

Recombinant Azospirillum brasilense Type-2 restriction enzyme AbrI (abrIR)

Sign In for Pricing
View Details
Recombinant Azospirillum brasilense Type-2 restriction enzyme AbrI (abrIR)
MBS1217285-03 0.02 mg (Yeast)

Recombinant Azospirillum brasilense Type-2 restriction enzyme AbrI (abrIR)

Sign In for Pricing
View Details
Recombinant Azospirillum brasilense Type-2 restriction enzyme AbrI (abrIR)
MBS1217285-04 0.1 mg (Yeast)

Recombinant Azospirillum brasilense Type-2 restriction enzyme AbrI (abrIR)

Sign In for Pricing
View Details