Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GGTL3 Rabbit Polyclonal Antibody (FITC)

GGTL3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

GGT4, GGTL3, GGTL5, D20S101

UniProt

B5MD39

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GGTL3

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_821158

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lymphoid tissue
CR562383 5 µg

Tissue Total RNA, Lymphoid tissue

Sign In for Pricing
View Details
MSI1 Mouse Monoclonal Antibody [Clone ID: 2A12]
AM06590SU-N 100 µL

MSI1 Mouse Monoclonal Antibody [Clone ID: 2A12]

Sign In for Pricing
View Details
RIT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A6]
TA501701AM 100 µL

RIT2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4A6]

Sign In for Pricing
View Details
iFluor™ 594 Conjugated Cytokeratin 4 Recombinant Rabbit Monoclonal Antibody [SN74-03]
HA720123F 100 µL

iFluor™ 594 Conjugated Cytokeratin 4 Recombinant Rabbit Monoclonal Antibody [SN74-03]

Sign In for Pricing
View Details
ANKRD43 (SOWAHA) Human Gene Knockout Kit (CRISPR)
KN424907 1 Kit

ANKRD43 (SOWAHA) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Rab43 Mouse Gene Knockout Kit (CRISPR)
KN514374 1 Kit

Rab43 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details