Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GGTL3 Rabbit Polyclonal Antibody (HRP)

GGTL3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GGT4, GGTL3, GGTL5, D20S101

UniProt

B5MD39

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GGTL3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ILLNSQMLDFSWPNRTANHSAPSLENSVQPGKRPLSFLLPTVVRPAEGLC

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

70kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_821158

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC6A6 Human Gene Knockout Kit (CRISPR)
KN419698 1 Kit

SLC6A6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (rSOX10/1074), CF488A conjugate, 0.1mg/mL
BNC882312-500 1x 500 µL

SOX10 (Melanoma Marker) (rSOX10/1074), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
cIAP1 (BIRC2) Rabbit Polyclonal Antibody
TA392505 100 µL

cIAP1 (BIRC2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SLC16A13 Human Gene Knockout Kit (CRISPR)
KN421552 1 Kit

SLC16A13 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cyp2d5 Goat Polyclonal Antibody
AP31683PU-N 100 µg

Cyp2d5 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Retinoic Acid Receptor beta (RARB) (NM_016152) Human Over-expression Lysate
LC402510 20 µg

Retinoic Acid Receptor beta (RARB) (NM_016152) Human Over-expression Lysate

Sign In for Pricing
View Details