Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Siglec-15, Human (HEK293, Fc)

The Siglec-15 protein plays a critical role in cellular interactions, selectively binding to sialylated glycoproteins with affinity for sialic acid residues. Binding to TYROBP and HCST suggests involvement in complex signaling pathways. Siglec-15 Protein, Human (HEK293, Fc) is the recombinant human-derived Siglec-15 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

Siglec-15 Protein, Human (HEK293, Fc), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/siglec-15-protein-human-hek-293-fc.html

Purity

96.64

Smiles

FVRTKIDTTENLLNTEVHSSPAQRWSMQVPPEVSAEAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIVNISVLPSPAHAFRALCTAEGEPPPALAWSGPALGNSLAAVRSPREGHGHLVTAELPALTHDGRYTCTAANSLGRSEASVYLFRFHGASGAST

Molecular Formula

284266 (Gene_ID) Q6ZMC9-1 (F20-T263) (Accession)

Molecular Weight

Approximately 50-80 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotinylated Anti-AXL antibody (EN0158) ; Rabbit mAb
E33E100158B 100 µL

Biotinylated Anti-AXL antibody (EN0158) ; Rabbit mAb

Sign In for Pricing
View Details
Mouse N-arachidonyl glycine receptor (GPR18) ELISA Kit
abx525988 96 Tests

Mouse N-arachidonyl glycine receptor (GPR18) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin-20 receptor subunit alpha, IL20RA ELISA KIT
ELI-03215h 96 Tests

Human Interleukin-20 receptor subunit alpha, IL20RA ELISA KIT

Sign In for Pricing
View Details
Human LSM5 activation kit by CRISPRa
GA108465 1 Kit

Human LSM5 activation kit by CRISPRa

Sign In for Pricing
View Details
CAV1 Protein Vector (Mouse) (pPB-C-His)
PV161802 500 ng

CAV1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Vom1r58 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6277106 1.0 µg DNA

Vom1r58 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details