Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTO2 Rabbit Polyclonal Antibody (HRP)

GSTO2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GSTO 2-2, bA127L20.1

UniProt

Q9H4Y5

Immunogen

The immunogen is a synthetic peptide directed towards the middle of human GSTO2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_899062

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Adrenomedullin (ADM) Polyclonal antibody
FY-AB34877-01 1 mL

Anti-Adrenomedullin (ADM) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Adrenomedullin (ADM) Polyclonal antibody
FY-AB34877-02 100 µL

Anti-Adrenomedullin (ADM) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Adrenomedullin (ADM) Polyclonal antibody
FY-AB34877-03 200 µL

Anti-Adrenomedullin (ADM) Polyclonal antibody

Sign In for Pricing
View Details
ScFv Isotype Control antibody
E55A06896 100 µg

ScFv Isotype Control antibody

Sign In for Pricing
View Details
IL-6 (Interleukin-6, BSF2, HGF, HSF, IFNB2) (AP)
MBS6188008-01 0.1 mL

IL-6 (Interleukin-6, BSF2, HGF, HSF, IFNB2) (AP)

Sign In for Pricing
View Details
IL-6 (Interleukin-6, BSF2, HGF, HSF, IFNB2) (AP)
MBS6188008-02 5x 0.1 mL

IL-6 (Interleukin-6, BSF2, HGF, HSF, IFNB2) (AP)

Sign In for Pricing
View Details