Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTO2 Rabbit Polyclonal Antibody (HRP)

GSTO2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GSTO 2-2, bA127L20.1

UniProt

Q9H4Y5

Immunogen

The immunogen is a synthetic peptide directed towards the middle of human GSTO2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_899062

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Grid1 (NM_008166) Mouse Tagged ORF Clone Lentiviral Particle
MR219008L4V 200 µL

Grid1 (NM_008166) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Carbazomycin D
C265-0.5MG 0.5 mg

Carbazomycin D

Sign In for Pricing
View Details
KDM5B Rabbit Polyclonal Antibody
TA351325 100 µL

KDM5B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MCF7/NF-kB Reporter (Luc) stable cell line
GTR15423104 1 Vial

MCF7/NF-kB Reporter (Luc) stable cell line

Sign In for Pricing
View Details
IL-5 CRISPR Activation Plasmid (h2)
sc-416860-ACT-2 20 µg

IL-5 CRISPR Activation Plasmid (h2)

Sign In for Pricing
View Details
SOD3, Human (His)
HY-P703945 1 Each

SOD3, Human (His)

Sign In for Pricing
View Details