Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GLCT Rabbit Polyclonal Antibody (HRP)

B3GLCT Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

B3GTL, Gal-T, B3GALTL, B3Glc-T, beta3Glc-T

UniProt

Q6Y288

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human B3GALTL

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DYPKDYLSHQVPISFHKHWNIDPVKVYFTWLAPSDEDKARQETQKGFREE

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

56kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_919299

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMACR (Alpha-methylacyl-CoA Racemase, 2-methylacyl-CoA Racemase) (Biotin)
137535-Biotin 100 µL

AMACR (Alpha-methylacyl-CoA Racemase, 2-methylacyl-CoA Racemase) (Biotin)

Sign In for Pricing
View Details
LYPLA3 (PLA2G15, Group XV Phospholipase A2, 1-O-acylceramide Synthase, ACS, LCAT-like Lysophospholipase, LLPL, Lysophospholipase 3, Lysosomal Phospholipase A2, LPLA2, UNQ341/PRO540) (MaxLight 405) discontinued
129270-ML405 100 µL

LYPLA3 (PLA2G15, Group XV Phospholipase A2, 1-O-acylceramide Synthase, ACS, LCAT-like Lysophospholipase, LLPL, Lysophospholipase 3, Lysosomal Phospholipase A2, LPLA2, UNQ341/PRO540) (MaxLight 405) discontinued

Sign In for Pricing
View Details
ASPHD1 siRNA (Mouse)
orb1836168-01 15 nmol

ASPHD1 siRNA (Mouse)

Sign In for Pricing
View Details
ASPHD1 siRNA (Mouse)
orb1836168-02 30 nmol

ASPHD1 siRNA (Mouse)

Sign In for Pricing
View Details
Human West nile virus IgG, WNV IgG ELISA KIT
ED0230Hu 96 Well

Human West nile virus IgG, WNV IgG ELISA KIT

Sign In for Pricing
View Details
FTL (Ferritin, Light Polypeptide, MGC71996) (MaxLight 650)
MBS6227679-01 0.1 mL

FTL (Ferritin, Light Polypeptide, MGC71996) (MaxLight 650)

Sign In for Pricing
View Details