Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC8 Rabbit Polyclonal Antibody (FITC)

TTC8 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BBS8, RP51

UniProt

Q8TAM2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TTC8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: ENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_938052

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-HDAC7 Antibody Picoband® Fluoro550 Conjugated
PB9629-Fluoro550 100 µg/Vial

Anti-HDAC7 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
TRPC6 polyclonal antibody
BS76124-01 50 µL

TRPC6 polyclonal antibody

Sign In for Pricing
View Details
TRPC6 polyclonal antibody
BS76124-02 100 µL

TRPC6 polyclonal antibody

Sign In for Pricing
View Details
COX6B2 (Cytochrome C Oxidase Subunit 6B2, Cancer/Testis Antigen 59, CT59, Cytochrome C Oxidase Subunit VIb Isoform 2, COX VIb-2, Cytochrome C Oxidase Subunit VIb, Testis-specific Isoform) (AP) discontinued
125261-AP 100 µL

COX6B2 (Cytochrome C Oxidase Subunit 6B2, Cancer/Testis Antigen 59, CT59, Cytochrome C Oxidase Subunit VIb Isoform 2, COX VIb-2, Cytochrome C Oxidase Subunit VIb, Testis-specific Isoform) (AP) discontinued

Sign In for Pricing
View Details
Anti-Dexras1 Polyclonal Antibody
TMAB-05107-01 50 μL

Anti-Dexras1 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Dexras1 Polyclonal Antibody
TMAB-05107-02 100 µL

Anti-Dexras1 Polyclonal Antibody

Sign In for Pricing
View Details