Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTC8 Rabbit Polyclonal Antibody (HRP)

TTC8 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BBS8, RP51

UniProt

Q8TAM2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TTC8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ENAIAQVPRPGTSLKLPGTNQTGGPSQAVRPITQAGRPITGFLRPSTQSG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_938052

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAA60 Antibody
orb1266218 400 μl

NAA60 Antibody

Sign In for Pricing
View Details
Sheep Protein Phosphatase 1 Regulatory Subunit 15B (PPP1R15B) ELISA Kit
MBS9394334-01 48 Well

Sheep Protein Phosphatase 1 Regulatory Subunit 15B (PPP1R15B) ELISA Kit

Sign In for Pricing
View Details
Sheep Protein Phosphatase 1 Regulatory Subunit 15B (PPP1R15B) ELISA Kit
MBS9394334-02 96 Well

Sheep Protein Phosphatase 1 Regulatory Subunit 15B (PPP1R15B) ELISA Kit

Sign In for Pricing
View Details
Sheep Protein Phosphatase 1 Regulatory Subunit 15B (PPP1R15B) ELISA Kit
MBS9394334-03 5x 96 Well

Sheep Protein Phosphatase 1 Regulatory Subunit 15B (PPP1R15B) ELISA Kit

Sign In for Pricing
View Details
Sheep Protein Phosphatase 1 Regulatory Subunit 15B (PPP1R15B) ELISA Kit
MBS9394334-04 10x 96 Well

Sheep Protein Phosphatase 1 Regulatory Subunit 15B (PPP1R15B) ELISA Kit

Sign In for Pricing
View Details
Recombinant Escherichia coli Molybdenum cofactor guanylyltransferase (mobA)
MBS1051074-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Molybdenum cofactor guanylyltransferase (mobA)

Sign In for Pricing
View Details