Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mgat5b Rabbit Polyclonal Antibody (FITC)

Mgat5b Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RP23-41E14.1, C330018B01, GnT-IX, mGnTVB

UniProt

D3ZRS9

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EGPAPLEAIANGCIFLQSRFSPPHSSLNHEFFRGKPTSREVFSQHPYAEN

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001100538

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cow Disialoganglioside GD1b
abx080076 1 mg

Cow Disialoganglioside GD1b

Sign In for Pricing
View Details
Mouse SP-A ELISA Kit
E065558 1 Each

Mouse SP-A ELISA Kit

Sign In for Pricing
View Details
Human ZNF516 Pre-designed siRNA Set A
SI018866A 1 Each

Human ZNF516 Pre-designed siRNA Set A

Sign In for Pricing
View Details
FA83G, CT (FAM83G, Protein FAM83G) (MaxLight 405) discontinued
035326-ML405 100 µL

FA83G, CT (FAM83G, Protein FAM83G) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Phospho-AMPK alpha 1 (Thr183) + AMPK alpha 2 (Thr172) Rabbit Polyclonal Antibody (Cy5.5)
orb1064570 100 µL

Phospho-AMPK alpha 1 (Thr183) + AMPK alpha 2 (Thr172) Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Human Interleukin 17 Receptor antagonist ELISA Kit
MBS7254271-01 48 Well

Human Interleukin 17 Receptor antagonist ELISA Kit

Sign In for Pricing
View Details