Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1AKMT2 Rabbit Polyclonal Antibody (Biotin)

EEF1AKMT2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Mettl1, Mettl10, 2010208K18Rik

UniProt

Q9D853

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAELL

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082371

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleoporin, 62kD, CT (NUP62, 62kD Nucleoporin, Nuclear Pore Glycoprotein p62, p62, DKFZp547L134, FLJ20822, FLJ43869, IBSN, MGC841, SNDI) (PE) discontinued
N7100-51C-PE 200 µL

Nucleoporin, 62kD, CT (NUP62, 62kD Nucleoporin, Nuclear Pore Glycoprotein p62, p62, DKFZp547L134, FLJ20822, FLJ43869, IBSN, MGC841, SNDI) (PE) discontinued

Sign In for Pricing
View Details
Mouse Vascular Cell Adhesion Protein 1 (CD106) ELISA Kit
MBS8420958-01 1 Kit

Mouse Vascular Cell Adhesion Protein 1 (CD106) ELISA Kit

Sign In for Pricing
View Details
Mouse Vascular Cell Adhesion Protein 1 (CD106) ELISA Kit
MBS8420958-02 5x 1 Kit

Mouse Vascular Cell Adhesion Protein 1 (CD106) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human NREP shRNA (UAS) - Lentiviral human NREP shRNA (UAS, GFP) (25)
GTR15099032 1 Vial

Lentiviral human NREP shRNA (UAS) - Lentiviral human NREP shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
3-Chloro-4-[3- (trifluoromethyl) -4,5,6,7-tetrahydro-1H-indazol-1-yl]aniline hydrochloride
GHC97008-01 100 mg

3-Chloro-4-[3- (trifluoromethyl) -4,5,6,7-tetrahydro-1H-indazol-1-yl]aniline hydrochloride

Sign In for Pricing
View Details
3-Chloro-4-[3- (trifluoromethyl) -4,5,6,7-tetrahydro-1H-indazol-1-yl]aniline hydrochloride
GHC97008-02 1 g

3-Chloro-4-[3- (trifluoromethyl) -4,5,6,7-tetrahydro-1H-indazol-1-yl]aniline hydrochloride

Sign In for Pricing
View Details