Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEF1AKMT2 Rabbit Polyclonal Antibody (HRP)

EEF1AKMT2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mettl1, Mettl10, 2010208K18Rik

UniProt

Q9D853

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VDKGTYDAISLNPDNAIEKRKQYVMSLSRVLEVKGFFLITSCNWTKAELL

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082371

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tumor Necrosis Factor Receptor 2, Soluble (sTNFR2) (FITC)
MBS6258455-01 0.1 mL

Tumor Necrosis Factor Receptor 2, Soluble (sTNFR2) (FITC)

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor 2, Soluble (sTNFR2) (FITC)
MBS6258455-02 5x 0.1 mL

Tumor Necrosis Factor Receptor 2, Soluble (sTNFR2) (FITC)

Sign In for Pricing
View Details
Anti-Human FGF1/aFGF Antibody (SAA0436), APC
ARO-A10336-01 50 µg

Anti-Human FGF1/aFGF Antibody (SAA0436), APC

Sign In for Pricing
View Details
Anti-Human FGF1/aFGF Antibody (SAA0436), APC
ARO-A10336-02 100 µg

Anti-Human FGF1/aFGF Antibody (SAA0436), APC

Sign In for Pricing
View Details
Anti-Human FGF1/aFGF Antibody (SAA0436), APC
ARO-A10336-03 1 mg

Anti-Human FGF1/aFGF Antibody (SAA0436), APC

Sign In for Pricing
View Details
Lentiviral human CYP2C18 shRNA (UAS) - Lentiviral human CYP2C18 shRNA (UAS, iRFP) plasmid
GTR15329251 1 Vial

Lentiviral human CYP2C18 shRNA (UAS) - Lentiviral human CYP2C18 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details