Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRIM2 Rabbit Polyclonal Antibody (HRP)

PRIM2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P58, PRIM2A

UniProt

Q5JU42

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PRIM2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

CAI42767

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acyl CoA Thioesterase 9 (ACOT9) (NM_001037171) Human Recombinant Protein
PROTQ9Y305 20 µg

Acyl CoA Thioesterase 9 (ACOT9) (NM_001037171) Human Recombinant Protein

Sign In for Pricing
View Details
C7orf34 siRNA Oligos set (Human)
14684171 3x 5 nmol

C7orf34 siRNA Oligos set (Human)

Sign In for Pricing
View Details
Sheep Uncoupling Protein 2 Antibody (Anti-UCP2) ELISA Kit
MBS9368680-01 48 Well

Sheep Uncoupling Protein 2 Antibody (Anti-UCP2) ELISA Kit

Sign In for Pricing
View Details
Sheep Uncoupling Protein 2 Antibody (Anti-UCP2) ELISA Kit
MBS9368680-02 96 Well

Sheep Uncoupling Protein 2 Antibody (Anti-UCP2) ELISA Kit

Sign In for Pricing
View Details
Sheep Uncoupling Protein 2 Antibody (Anti-UCP2) ELISA Kit
MBS9368680-03 5x 96 Well

Sheep Uncoupling Protein 2 Antibody (Anti-UCP2) ELISA Kit

Sign In for Pricing
View Details
Sheep Uncoupling Protein 2 Antibody (Anti-UCP2) ELISA Kit
MBS9368680-04 10x 96 Well

Sheep Uncoupling Protein 2 Antibody (Anti-UCP2) ELISA Kit

Sign In for Pricing
View Details