Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTT4 Rabbit Polyclonal Antibody (Biotin)

GSTT4 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

A8MPT4

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human GSTT4

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LAEWRMQVELNIGSGLFREAHDRLMQLADWDFSTLDSMVKENISELLKKS

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

26kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hybex™ Erlenmeyer Flask, threaded with cap, 250ml, case of 12
B3220-250 1 Each

Hybex™ Erlenmeyer Flask, threaded with cap, 250ml, case of 12

Sign In for Pricing
View Details
BOC-Statine [BOC-Sta (3S,4S) -OH] *CAS 58521-49-6*
5100-AAT 1 g

BOC-Statine [BOC-Sta (3S,4S) -OH] *CAS 58521-49-6*

Sign In for Pricing
View Details
Large Capacity Water Purification System BCPS-405
BCPS-405 1 Unit

Large Capacity Water Purification System BCPS-405

Sign In for Pricing
View Details
Cytokeratin 14 (LL002), CF640R conjugate, 0.1mg/mL
BNC400499-100 1x 100 µL

Cytokeratin 14 (LL002), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), CF488A conjugate, 0.1mg/mL
BNC882172-100 1x 100 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), 1mg/mL
BNUM1948-50 1x 50 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (KRT10/1948R), 1mg/mL

Sign In for Pricing
View Details