Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG1 Rabbit Polyclonal Antibody (Biotin)

ALG1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HMT1, MT-1, CDG1K, HMAT1, HMT-1, Mat-1, hMat-1

UniProt

B4DP08

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ALG1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061982.3

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SPX (Spexin) ELISA Kit
ELK8816-01 48 Tests

Human SPX (Spexin) ELISA Kit

Sign In for Pricing
View Details
Human SPX (Spexin) ELISA Kit
ELK8816-02 96 Tests

Human SPX (Spexin) ELISA Kit

Sign In for Pricing
View Details
Human SPX (Spexin) ELISA Kit
ELK8816-03 5x 96 Tests

Human SPX (Spexin) ELISA Kit

Sign In for Pricing
View Details
FOXD1 Antibody - N-terminal region : HRP (ARP36876_P050-HRP)
ARP36876_P050-HRP 100 µL

FOXD1 Antibody - N-terminal region : HRP (ARP36876_P050-HRP)

Sign In for Pricing
View Details
Convex pad, for tubes and vessels with dia.<99mm, use with TT-VM-P
TT-VM-2 1 Unit

Convex pad, for tubes and vessels with dia.<99mm, use with TT-VM-P

Sign In for Pricing
View Details
Porcine Gamma-Secretase (GS) ELISA Kit
MBS9390086-01 48 Well

Porcine Gamma-Secretase (GS) ELISA Kit

Sign In for Pricing
View Details