Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALG1 Rabbit Polyclonal Antibody (Biotin)

ALG1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HMT1, MT-1, CDG1K, HMAT1, HMT-1, Mat-1, hMat-1

UniProt

B4DP08

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human ALG1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VKHEENGLVFEDSEELAAQLQMLFSNFPDPAGKLNQFRKNLRESQQLRWD

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061982.3

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD13/ANPEP Mouse Monoclonal Antibody (Fluoro594)
orb3084817 100 µg

CD13/ANPEP Mouse Monoclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Mouse Monoclonal CD7 Antibody (848438) [mFluor Violet 610 SE]
FAB7579MFV610 0.1 mL

Mouse Monoclonal CD7 Antibody (848438) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
TSH beta (TSHB) Mouse Monoclonal Antibody [Clone ID: 204-12252]
AM05118PU-N 1 mg

TSH beta (TSHB) Mouse Monoclonal Antibody [Clone ID: 204-12252]

Sign In for Pricing
View Details
TMEM131L (KIAA0922) (NM_001131007) Human Tagged ORF Clone
RC226409 10 µg

TMEM131L (KIAA0922) (NM_001131007) Human Tagged ORF Clone

Sign In for Pricing
View Details
Dickkopf Related Protein 4 (DKK4) Recombinant, Mouse
154358-01 10 µg

Dickkopf Related Protein 4 (DKK4) Recombinant, Mouse

Sign In for Pricing
View Details
Dickkopf Related Protein 4 (DKK4) Recombinant, Mouse
154358-02 50 µg

Dickkopf Related Protein 4 (DKK4) Recombinant, Mouse

Sign In for Pricing
View Details