Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIPT2 Rabbit Polyclonal Antibody (HRP)

LIPT2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

A6NK58

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human LIPT2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TDLTWFEHIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001138341

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9ORF106 (Putative Uncharacterized Protein C9orf106)
476877 100 µL

C9ORF106 (Putative Uncharacterized Protein C9orf106)

Sign In for Pricing
View Details
EMID2 3'UTR GFP Stable Cell Line
TU056863 1.0 mL

EMID2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD8a Antibody[OX-8]
E-AB-F1098UM1-01 25 µg

Elab Fluor® 700 Anti-Rat CD8a Antibody[OX-8]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Rat CD8a Antibody[OX-8]
E-AB-F1098UM1-02 100 µg

Elab Fluor® 700 Anti-Rat CD8a Antibody[OX-8]

Sign In for Pricing
View Details
Human Heat Shock Protein 70 (HSP70) Protein
abx675003-01 50 µg

Human Heat Shock Protein 70 (HSP70) Protein

Sign In for Pricing
View Details
Human Heat Shock Protein 70 (HSP70) Protein
abx675003-02 100 µg

Human Heat Shock Protein 70 (HSP70) Protein

Sign In for Pricing
View Details