Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Setd5 Rabbit Polyclonal Antibody (HRP)

Setd5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C85544, mKIAA1757, C330007C20, 2900045N06Rik

UniProt

Q5XJV7

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Setd5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESNITEKESDPADGEGPEPLSSALSKGATVYSPSRYSYQLLQCDSPRTES

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

157kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_082661

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNOT1 Polyclonal Antibody
ANT-11574-50ug 50 µg

CNOT1 Polyclonal Antibody

Sign In for Pricing
View Details
DCP1B, ID (DCP1B, mRNA-decapping enzyme 1B) (MaxLight 750)
MBS6291154-01 0.1 mL

DCP1B, ID (DCP1B, mRNA-decapping enzyme 1B) (MaxLight 750)

Sign In for Pricing
View Details
DCP1B, ID (DCP1B, mRNA-decapping enzyme 1B) (MaxLight 750)
MBS6291154-02 5x 0.1 mL

DCP1B, ID (DCP1B, mRNA-decapping enzyme 1B) (MaxLight 750)

Sign In for Pricing
View Details
Pi-PEG Screen HTS (1.7 ml per well)
M-CS-212L 96 Solutions

Pi-PEG Screen HTS (1.7 ml per well)

Sign In for Pricing
View Details
Hsa-miR-3922-3p miRNA Agomir
CMJ1191-01 5 nmol

Hsa-miR-3922-3p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-3922-3p miRNA Agomir
CMJ1191-02 10 nmol

Hsa-miR-3922-3p miRNA Agomir

Sign In for Pricing
View Details