Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C9orf46 Rabbit Polyclonal Antibody (HRP)

C9orf46 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AD025, MDS030, C9orf46, PLG-RKT, Plg-R (KT)

UniProt

Q9HBL7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C9orf46

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

17kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060935

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD14 Antibody (433423) [PerCP]
FAB4597C 0.1 mL

Mouse Monoclonal CD14 Antibody (433423) [PerCP]

Sign In for Pricing
View Details
MYCL (MYCL1, v-Myc Myelocytomatosis Viral Oncogene Homolog 1 Lung Carcinoma Derived (Avian), Class E Basic Helix-loop-helix Protein 38, bHLHe38, LMYC, L-Myc, L-myc-1 Proto-oncogene Protein) (AP) discontinued
130044-AP 100 µL

MYCL (MYCL1, v-Myc Myelocytomatosis Viral Oncogene Homolog 1 Lung Carcinoma Derived (Avian), Class E Basic Helix-loop-helix Protein 38, bHLHe38, LMYC, L-Myc, L-myc-1 Proto-oncogene Protein) (AP) discontinued

Sign In for Pricing
View Details
Mouse Bradykinin (BK) Antibody Pair Kit (with Standard)
MBS2099608-01 5x 96 Tests

Mouse Bradykinin (BK) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Bradykinin (BK) Antibody Pair Kit (with Standard)
MBS2099608-02 5x 96 Tests + MBS2090686 (Ab Pairs Support Pack 2,5x 96 Tests)

Mouse Bradykinin (BK) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Bradykinin (BK) Antibody Pair Kit (with Standard)
MBS2099608-03 10x 96 Tests

Mouse Bradykinin (BK) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details
Mouse Bradykinin (BK) Antibody Pair Kit (with Standard)
MBS2099608-04 10x 96 Tests + MBS2090686 (Ab Pairs Support Pack 2, 10x 96 Tests)

Mouse Bradykinin (BK) Antibody Pair Kit (with Standard)

Sign In for Pricing
View Details