Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmem165 Rabbit Polyclonal Antibody (FITC)

Tmem165 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

T, Tp, pFT2, Tparl, pFT27, Tpardl, AV026557

UniProt

P52875

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Tmem165

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAAAARGSGRAPTRRLLVLLLLQLLWAPAGVRAGPEEDLSHRNQEPPAPA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_035756

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LBHD1 Pre-designed siRNA Set B
SI008572B 1 Each

Human LBHD1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Human HYOU1 (Hypoxia Up Regulated 1) ELISA Kit
ELK3096-01 48 Tests

Human HYOU1 (Hypoxia Up Regulated 1) ELISA Kit

Sign In for Pricing
View Details
Human HYOU1 (Hypoxia Up Regulated 1) ELISA Kit
ELK3096-02 96 Tests

Human HYOU1 (Hypoxia Up Regulated 1) ELISA Kit

Sign In for Pricing
View Details
Human HYOU1 (Hypoxia Up Regulated 1) ELISA Kit
ELK3096-03 5x 96 Tests

Human HYOU1 (Hypoxia Up Regulated 1) ELISA Kit

Sign In for Pricing
View Details
SLC23A2 (NM_203327) Human Over-expression Lysate
E45H16561-2 20 µg

SLC23A2 (NM_203327) Human Over-expression Lysate

Sign In for Pricing
View Details
PZP Rabbit pAb
E45R25211N 50 ul

PZP Rabbit pAb

Sign In for Pricing
View Details