Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM126B Rabbit Polyclonal Antibody (Biotin)

TMEM126B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HT007, MC1DN29

UniProt

Q8IUX1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM126B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AASMHGQPSPSLEDAKLRRPMVIEIIEKNFDYLRKEMTQNIYQMATFGTT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_060950

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p16 INK recombinant monoclonal antibody
A5869 100ul X 3

p16 INK recombinant monoclonal antibody

Sign In for Pricing
View Details
CyPB Polyclonal Antibody
MBS9246052-01 0.1 mL

CyPB Polyclonal Antibody

Sign In for Pricing
View Details
CyPB Polyclonal Antibody
MBS9246052-02 5x 0.1 mL

CyPB Polyclonal Antibody

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)
MBS2146345-01 0.1 mL

Cy3-Linked Monoclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)
MBS2146345-02 0.2 mL

Cy3-Linked Monoclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)

Sign In for Pricing
View Details
Cy3-Linked Monoclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)
MBS2146345-03 0.5 mL

Cy3-Linked Monoclonal Antibody to Troponin T Type 2, Cardiac (TNNT2)

Sign In for Pricing
View Details