Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM126B Rabbit Polyclonal Antibody (Biotin)

TMEM126B Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HT007, MC1DN29

UniProt

A8K535

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM126B

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060950

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Syntaxin-17 Antibody (Fluoro594)
orb3165411 100 µg

Syntaxin-17 Antibody (Fluoro594)

Sign In for Pricing
View Details
Trmt9b Rat shRNA Lentiviral Particle (Locus ID 306504)
TL705881V 500 µL Each

Trmt9b Rat shRNA Lentiviral Particle (Locus ID 306504)

Sign In for Pricing
View Details
IL-12B Recombinant Rabbit mAb, capture
E47P0019C 100 µL

IL-12B Recombinant Rabbit mAb, capture

Sign In for Pricing
View Details
HMG20B Antibody APC Conjugated
orb3168676 100 µg

HMG20B Antibody APC Conjugated

Sign In for Pricing
View Details
ELISA Kit for Gastrin Releasing Peptide (GRP)
TRV-0004659-01 24 Tests

ELISA Kit for Gastrin Releasing Peptide (GRP)

Sign In for Pricing
View Details
ELISA Kit for Gastrin Releasing Peptide (GRP)
TRV-0004659-02 48 Tests

ELISA Kit for Gastrin Releasing Peptide (GRP)

Sign In for Pricing
View Details