Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM126B Rabbit Polyclonal Antibody (FITC)

TMEM126B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HT007, MC1DN29

UniProt

A8K535

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM126B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060950

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cracd Mouse Gene Knockout Kit (CRISPR)
KN502382 1 Kit

Cracd Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PDE1A Rabbit Polyclonal Antibody
AP00651SU-N 100 µL

PDE1A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lysophospholipase 1 Recombinant Rabbit Monoclonal Antibody [JE47-60]
ET7109-63 100 µL

Lysophospholipase 1 Recombinant Rabbit Monoclonal Antibody [JE47-60]

Sign In for Pricing
View Details
GPCR 2037 (GPR151) Human Gene Knockout Kit (CRISPR)
KN420856 1 Kit

GPCR 2037 (GPR151) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Kappa Light Chain (HP6053), CF594 conjugate, 0.1mg/mL
BNC940681-500 1x 500 µL

Human Kappa Light Chain (HP6053), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Density Regulated Protein (DENR) Rabbit Polyclonal Antibody
TA372415 100 µL

Density Regulated Protein (DENR) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details