Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM126B Rabbit Polyclonal Antibody (HRP)

TMEM126B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HT007, MC1DN29

UniProt

A8K535

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM126B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060950

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goose Spectrin Beta, Non Erythrocytic 4 ELISA Kit
MBS087048 Inquire

Goose Spectrin Beta, Non Erythrocytic 4 ELISA Kit

Sign In for Pricing
View Details
Xylosyltransferase 2 (XYLT2) Bovine ELISA Kit
I2965 96 Tests

Xylosyltransferase 2 (XYLT2) Bovine ELISA Kit

Sign In for Pricing
View Details
HnRNP Q/R Rabbit mAb
C05798-20uL 20 µL

HnRNP Q/R Rabbit mAb

Sign In for Pricing
View Details
8-oxo dA 25 nmol scale
26-6905-25 1 Each

8-oxo dA 25 nmol scale

Sign In for Pricing
View Details
1- (4-Carboxyphenyl) -6-oxo-1,4,5,6-tetra-hydropyridazine-3-carboxylic acid
sc-302316 500 mg

1- (4-Carboxyphenyl) -6-oxo-1,4,5,6-tetra-hydropyridazine-3-carboxylic acid

Sign In for Pricing
View Details
Anti-FOXP2 Antibody Picoband® (Dylight594 Conjugate)
A01329-1-Dylight594 100 µg

Anti-FOXP2 Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details