Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMEM126B Rabbit Polyclonal Antibody (HRP)

TMEM126B Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HT007, MC1DN29

UniProt

A8K535

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMEM126B

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VFRSSLIGIVCGVFYPSSLAFTKNGRLATKYHTVPLPPKGRVLIHWMTLC

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

23kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_060950

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal 14-3-3 gamma Antibody (6A10)
H00007532-M02 0.1 mg

Mouse Monoclonal 14-3-3 gamma Antibody (6A10)

Sign In for Pricing
View Details
Recombinant Yersinia Enterocolitica YE1335 Protein (aa 1-151) (strain 8081)
VAng-Wyb1947-inquire Inquire

Recombinant Yersinia Enterocolitica YE1335 Protein (aa 1-151) (strain 8081)

Sign In for Pricing
View Details
SLC10A4 shRNA (h) Lentiviral Particles
sc-89223-V 200 µL

SLC10A4 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
NDRG2 (NM_016250) Human Tagged Lenti ORF Clone
RC211577L3 10 µg

NDRG2 (NM_016250) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
LIMK1 Polyclonal Antibody, Biotin Conjugated
bs-2775R-Biotin 100 µL

LIMK1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Gtpbp4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
22821114 3x 1.0 µg

Gtpbp4 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details