Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSGALNACT2 Rabbit Polyclonal Antibody (HRP)

CSGALNACT2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CHGN2, ChGn-2, PRO0082, GALNACT2, GALNACT-2, beta4GalNAcT

UniProt

Q8N6G5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human CGAT2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGVVGENYGKEYYQALLQEQEEHYQTRATSLKRQIAQLKQELQEMSEKMR

Field of Research

Signal Transduction

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

XP_005271877

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr448 Protein Vector (Mouse) (pPM-C-His)
PV210509 500 ng

Olfr448 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Recombinant Human NRG4 protein
MBS1562800-01 0.05 mg

Recombinant Human NRG4 protein

Sign In for Pricing
View Details
Recombinant Human NRG4 protein
MBS1562800-02 0.1 mg

Recombinant Human NRG4 protein

Sign In for Pricing
View Details
Recombinant Human NRG4 protein
MBS1562800-03 5x 0.1 mg

Recombinant Human NRG4 protein

Sign In for Pricing
View Details
Rabbit anti-human Casein kinase II subunit beta polyclonal Antibody, HRP conjugated
MBS715265-01 0.05 mg

Rabbit anti-human Casein kinase II subunit beta polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details
Rabbit anti-human Casein kinase II subunit beta polyclonal Antibody, HRP conjugated
MBS715265-02 0.1 mg

Rabbit anti-human Casein kinase II subunit beta polyclonal Antibody, HRP conjugated

Sign In for Pricing
View Details