Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULF2 Rabbit Polyclonal Antibody (HRP)

SULF2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HSULF-2

UniProt

Q8IWU5

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SULF2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKW

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

98kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_061325

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Clara Cell Protein 16 (CC16) Mini Samples ELISA Kit
MBS2087660-01 24 Strip Well

Mouse Clara Cell Protein 16 (CC16) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Clara Cell Protein 16 (CC16) Mini Samples ELISA Kit
MBS2087660-02 48 Well

Mouse Clara Cell Protein 16 (CC16) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Clara Cell Protein 16 (CC16) Mini Samples ELISA Kit
MBS2087660-03 96 Well

Mouse Clara Cell Protein 16 (CC16) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Clara Cell Protein 16 (CC16) Mini Samples ELISA Kit
MBS2087660-04 5x 96 Well

Mouse Clara Cell Protein 16 (CC16) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Mouse Clara Cell Protein 16 (CC16) Mini Samples ELISA Kit
MBS2087660-05 10x 96 Well

Mouse Clara Cell Protein 16 (CC16) Mini Samples ELISA Kit

Sign In for Pricing
View Details
Human Mineralocorticoid receptor (Nr3c2) ELISA Kit
CK-bio-24104-01 48 Tests

Human Mineralocorticoid receptor (Nr3c2) ELISA Kit

Sign In for Pricing
View Details