Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB5IF Rabbit Polyclonal Antibody (HRP)

RAB5IF Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

RIP5, RCAF1, PNAS-11, C20orf24

UniProt

Q9BUV8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C20orf24

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSGGRRKEEPPQPQLANGALKVSVWSKVLRSDAAWEDKDEFLDVIYWFRQ

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

15kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast

Tested Applications

WB

NCBI Accession Number

NP_061328

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX49 Rabbit Polyclonal Antibody (BF405)
orb2515776 100 µL

DDX49 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Recombinant Roseobacter denitrificans Urease subunit beta (ureB)
MBS1315496-01 0.05 mg (E-Coli)

Recombinant Roseobacter denitrificans Urease subunit beta (ureB)

Sign In for Pricing
View Details
Recombinant Roseobacter denitrificans Urease subunit beta (ureB)
MBS1315496-02 0.2 mg (E-Coli)

Recombinant Roseobacter denitrificans Urease subunit beta (ureB)

Sign In for Pricing
View Details
Recombinant Roseobacter denitrificans Urease subunit beta (ureB)
MBS1315496-03 0.05 mg (Yeast)

Recombinant Roseobacter denitrificans Urease subunit beta (ureB)

Sign In for Pricing
View Details
Recombinant Roseobacter denitrificans Urease subunit beta (ureB)
MBS1315496-04 0.5 mg (E-Coli)

Recombinant Roseobacter denitrificans Urease subunit beta (ureB)

Sign In for Pricing
View Details
Recombinant Roseobacter denitrificans Urease subunit beta (ureB)
MBS1315496-05 0.05 mg (Baculovirus)

Recombinant Roseobacter denitrificans Urease subunit beta (ureB)

Sign In for Pricing
View Details