Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDHAC2 Rabbit Polyclonal Antibody (Biotin)

PCDHAC2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

PCDH-ALPHA-C2

UniProt

Q9Y5I4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PCDHAC2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

105kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_061722

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FoxP1 Rabbit Polyclonal Antibody (PerCP)
orb1597824 100 µL

FoxP1 Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
GENLISA Human Specific Macrophage Arming Factor (SMAF) ELISA
KBH16331 1x 96 Well

GENLISA Human Specific Macrophage Arming Factor (SMAF) ELISA

Sign In for Pricing
View Details
PKC nu, CT (Serine/Threonine-protein Kinase D3, Protein Kinase C, nu Type, nPKC-nu, Protein Kinase EPK2, PRKD3, PRKCN, EPK2) (Azide free) (HRP)
MBS6495195-01 0.2 mL

PKC nu, CT (Serine/Threonine-protein Kinase D3, Protein Kinase C, nu Type, nPKC-nu, Protein Kinase EPK2, PRKD3, PRKCN, EPK2) (Azide free) (HRP)

Sign In for Pricing
View Details
PKC nu, CT (Serine/Threonine-protein Kinase D3, Protein Kinase C, nu Type, nPKC-nu, Protein Kinase EPK2, PRKD3, PRKCN, EPK2) (Azide free) (HRP)
MBS6495195-02 5x 0.2 mL

PKC nu, CT (Serine/Threonine-protein Kinase D3, Protein Kinase C, nu Type, nPKC-nu, Protein Kinase EPK2, PRKD3, PRKCN, EPK2) (Azide free) (HRP)

Sign In for Pricing
View Details
Choline Kinase alpha (CHK) (C-Term) Rabbit pAb
MBS8555259-01 0.1 mL

Choline Kinase alpha (CHK) (C-Term) Rabbit pAb

Sign In for Pricing
View Details
Choline Kinase alpha (CHK) (C-Term) Rabbit pAb
MBS8555259-02 0.1 mL (AF405L)

Choline Kinase alpha (CHK) (C-Term) Rabbit pAb

Sign In for Pricing
View Details