Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Human (His)

IL-33 protein, as a cytokine, binds to and signals through the IL1RL1/ST2 receptor, thereby activating the NF-kappa-B and MAPK signaling pathways in target cells. It is involved in the maturation of Th2 cells and contributes to the secretion of T helper cell type 2 related cytokines. IL-33 Protein, Human (His) is the recombinant human-derived IL-33 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-33 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-human-his.html

Purity

96.70

Smiles

SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Molecular Formula

90865 (Gene_ID) O95760-1 (S112-T270) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mubritinib (TAK 165)
MBS578692 Inquire

Mubritinib (TAK 165)

Sign In for Pricing
View Details
PF4V1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1630207 1.0 µg DNA

PF4V1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
EEF1DP4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV723890 1.0 µg DNA

EEF1DP4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
Keratin, Multi (BSA & Azide Free) discontinued
K0199-85X 100 µg

Keratin, Multi (BSA & Azide Free) discontinued

Sign In for Pricing
View Details
GATA1 Rabbit Polyclonal Antibody (Fluoro488)
orb3118545 100 µg

GATA1 Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Nudt16 siRNA Oligos set (Rat)
32284176 3x 5 nmol

Nudt16 siRNA Oligos set (Rat)

Sign In for Pricing
View Details