Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Human (His)

IL-33 protein, as a cytokine, binds to and signals through the IL1RL1/ST2 receptor, thereby activating the NF-kappa-B and MAPK signaling pathways in target cells. It is involved in the maturation of Th2 cells and contributes to the secretion of T helper cell type 2 related cytokines. IL-33 Protein, Human (His) is the recombinant human-derived IL-33 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-33 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-human-his.html

Purity

96.70

Smiles

SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Molecular Formula

90865 (Gene_ID) O95760-1 (S112-T270) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABC A7 (ATP-binding Cassette (ABC) Sub-family A Member 7, Macrophage ABC Transporter, Autoantigen SS-N, ABCA-SSN) discontinued
A0004-02P1 250 µg

ABC A7 (ATP-binding Cassette (ABC) Sub-family A Member 7, Macrophage ABC Transporter, Autoantigen SS-N, ABCA-SSN) discontinued

Sign In for Pricing
View Details
Human PSMD11 shRNA Plasmid
abx953862-01 150 µg

Human PSMD11 shRNA Plasmid

Sign In for Pricing
View Details
Human PSMD11 shRNA Plasmid
abx953862-02 300 µg

Human PSMD11 shRNA Plasmid

Sign In for Pricing
View Details
Lentiviral mouse Fnbp1 shRNA (UAS) - Lentiviral mouse Fnbp1 shRNA (UAS, RFP) (25)
GTR15130151 1 Vial

Lentiviral mouse Fnbp1 shRNA (UAS) - Lentiviral mouse Fnbp1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
ZNF785, NT (ZNF785, Zinc finger protein 785) (MaxLight 405)
MBS6367773-01 0.1 mL

ZNF785, NT (ZNF785, Zinc finger protein 785) (MaxLight 405)

Sign In for Pricing
View Details
ZNF785, NT (ZNF785, Zinc finger protein 785) (MaxLight 405)
MBS6367773-02 5x 0.1 mL

ZNF785, NT (ZNF785, Zinc finger protein 785) (MaxLight 405)

Sign In for Pricing
View Details