Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-33, Human (His)

IL-33 protein, as a cytokine, binds to and signals through the IL1RL1/ST2 receptor, thereby activating the NF-kappa-B and MAPK signaling pathways in target cells. It is involved in the maturation of Th2 cells and contributes to the secretion of T helper cell type 2 related cytokines. IL-33 Protein, Human (His) is the recombinant human-derived IL-33 protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

IL-33 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-33-protein-human-his.html

Purity

96.70

Smiles

SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

Molecular Formula

90865 (Gene_ID) O95760-1 (S112-T270) (Accession)

Molecular Weight

Approximately 21 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Rabbit Polyclonal BICD2 Antibody [DyLight 755]
NBP2-81961IR 0.1 mL

Rabbit Polyclonal BICD2 Antibody [DyLight 755]

Ask
View Details
Rat Rnf6 Pre-designed siRNA Set A
SI212069A 1 Each

Rat Rnf6 Pre-designed siRNA Set A

Ask
View Details
Lentiviral human CLCN3 sgRNA gene knockout kit - Lentiviral human CLCN3 sgRNA gene knockout kit (plasmid)
GTR15396164 1 Vial

Lentiviral human CLCN3 sgRNA gene knockout kit - Lentiviral human CLCN3 sgRNA gene knockout kit (plasmid)

Ask
View Details
RPS6KA1 (RPS6KA1, MAPKAPK1A, RSK1, Ribosomal protein S6 kinase alpha-1, 90kD ribosomal protein S6 kinase 1, MAP kinase-activated protein kinase 1a, Ribosomal S6 kinase 1) (AP) discontinued
041250-AP 200 µL

RPS6KA1 (RPS6KA1, MAPKAPK1A, RSK1, Ribosomal protein S6 kinase alpha-1, 90kD ribosomal protein S6 kinase 1, MAP kinase-activated protein kinase 1a, Ribosomal S6 kinase 1) (AP) discontinued

Ask
View Details
Rabbit Polyclonal AAMP Antibody
NBP3-12703-50ul 50 µL

Rabbit Polyclonal AAMP Antibody

Ask
View Details
Fbxo18 (NM_015792) Mouse Tagged Lenti ORF Clone
MR211513L3 10 µg

Fbxo18 (NM_015792) Mouse Tagged Lenti ORF Clone

Ask
View Details