Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDHGC5 Rabbit Polyclonal Antibody (FITC)

PCDHGC5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PCDH-GAMMA-C5

UniProt

Q9Y5F6

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence RVGIPENAPIGTLLLRLNATDPDEGTNGQLDYSFGDHTSEAVRNLFGLDP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RVGIPENAPIGTLLLRLNATDPDEGTNGQLDYSFGDHTSEAVRNLFGLDP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

102 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_061752

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epidermal Growth Factor Receptor (EGFR) Antibody
abx330940 100 µL

Epidermal Growth Factor Receptor (EGFR) Antibody

Sign In for Pricing
View Details
O52R1 rabbit pAb Antibody
orb774556-01 50 μL

O52R1 rabbit pAb Antibody

Sign In for Pricing
View Details
O52R1 rabbit pAb Antibody
orb774556-02 100 µL

O52R1 rabbit pAb Antibody

Sign In for Pricing
View Details
Monoamine oxidase A+B Rabbit Polyclonal Antibody (BF750)
orb1610705 100 µL

Monoamine oxidase A+B Rabbit Polyclonal Antibody (BF750)

Sign In for Pricing
View Details
Recombinant Moorella thermoacetica Elongation factor Ts (tsf)
MBS1483740-01 0.02 mg (E-Coli)

Recombinant Moorella thermoacetica Elongation factor Ts (tsf)

Sign In for Pricing
View Details
Recombinant Moorella thermoacetica Elongation factor Ts (tsf)
MBS1483740-02 0.1 mg (E-Coli)

Recombinant Moorella thermoacetica Elongation factor Ts (tsf)

Sign In for Pricing
View Details