Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDHGC5 Rabbit Polyclonal Antibody (FITC)

PCDHGC5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PCDH-GAMMA-C5

UniProt

Q9Y5F6

Immunogen

The immunogen is a synthetic peptide directed towards the following sequence RVGIPENAPIGTLLLRLNATDPDEGTNGQLDYSFGDHTSEAVRNLFGLDP

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RVGIPENAPIGTLLLRLNATDPDEGTNGQLDYSFGDHTSEAVRNLFGLDP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

102 kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

NCBI Accession Number

NP_061752

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

EBI3 (Interleukin-27 Subunit beta, IL-27 Subunit beta, IL-27B, Epstein-Barr Virus-induced Gene 3 Protein, EBV-induced Gene 3 Protein, IL27B) discontinued
E3440-50D 100 µg

EBI3 (Interleukin-27 Subunit beta, IL-27 Subunit beta, IL-27B, Epstein-Barr Virus-induced Gene 3 Protein, EBV-induced Gene 3 Protein, IL27B) discontinued

Sign In for Pricing
View Details
Rabbit Anti-OR2S1/OR2S2 Polyclonal Antibody
PAV2777 100 μL

Rabbit Anti-OR2S1/OR2S2 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal CNOT6 Antibody
NBP2-99135-50ul 50 µL

Rabbit Polyclonal CNOT6 Antibody

Sign In for Pricing
View Details
ESM1 Rabbit Polyclonal Antibody (Fluoro594)
orb3106271 100 µg

ESM1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
GJD2 Protein Vector (Rat) (pPM-C-HA)
21553026 500 ng

GJD2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
COMMD5 Rabbit pAb (APR23112N)
APR23112N-01 50 µL

COMMD5 Rabbit pAb (APR23112N)

Sign In for Pricing
View Details