Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YIPF1 Rabbit Polyclonal Antibody (HRP)

YIPF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FinGER1, DJ167A19.1

UniProt

Q9Y548

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human YIPF1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HLGEKTYHYVPEFRKVSIAATIIYAYAWLVPLALWGFLMWRNSKVMNIVS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061855

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Upadacitinib 6-N-Oxide Impurity
CS-O-58934 1 Each

Upadacitinib 6-N-Oxide Impurity

Sign In for Pricing
View Details
Mouse anti-human IgE mAb
A03B07-m 1 Each

Mouse anti-human IgE mAb

Sign In for Pricing
View Details
Mouse Monoclonal CD3 zeta Antibody (06) [Janelia Fluor 585]
NBP3-20221JF585 0.1 mL

Mouse Monoclonal CD3 zeta Antibody (06) [Janelia Fluor 585]

Sign In for Pricing
View Details
TIN-Ag CRISPR Activation Plasmid (h)
sc-411985-ACT 20 µg

TIN-Ag CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
ILF3 Rabbit Polyclonal Antibody
TA377489 100 µL

ILF3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Gm5460 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3232305 3x 1.0 µg

Gm5460 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details