Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YIPF1 Rabbit Polyclonal Antibody (Biotin)

YIPF1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FinGER1, DJ167A19.1

UniProt

Q9Y548

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VALATIVTIVLLHMLLSVGCLAYFFDAPEMDHLPTTTATPNQTVAAAKSS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061855

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brk1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
13482126 3x 1.0µg DNA

Brk1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Pfdn5 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3881804 1.0 µg DNA

Pfdn5 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Lentiviral mouse Gm266 shRNA (UAS) - Lentiviral mouse Gm266 shRNA (UAS, RFP) (25)
GTR15295898 1 Vial

Lentiviral mouse Gm266 shRNA (UAS) - Lentiviral mouse Gm266 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rabbit Polyclonal IARS2 Antibody [DyLight 350]
NBP3-18443UV 0.1 mL

Rabbit Polyclonal IARS2 Antibody [DyLight 350]

Sign In for Pricing
View Details
Human UGT1A10 Protein Lysate
MBS8429507-01 0.02 mg

Human UGT1A10 Protein Lysate

Sign In for Pricing
View Details
Human UGT1A10 Protein Lysate
MBS8429507-02 5x 0.02 mg

Human UGT1A10 Protein Lysate

Sign In for Pricing
View Details