Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YIPF1 Rabbit Polyclonal Antibody (HRP)

YIPF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FinGER1, DJ167A19.1

UniProt

Q9Y548

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VALATIVTIVLLHMLLSVGCLAYFFDAPEMDHLPTTTATPNQTVAAAKSS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061855

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYRK2 (DYRK2, Dual specificity tyrosine-phosphorylation-regulated kinase 2) (MaxLight 550)
MBS6257725-01 0.1 mL

DYRK2 (DYRK2, Dual specificity tyrosine-phosphorylation-regulated kinase 2) (MaxLight 550)

Sign In for Pricing
View Details
DYRK2 (DYRK2, Dual specificity tyrosine-phosphorylation-regulated kinase 2) (MaxLight 550)
MBS6257725-02 5x 0.1 mL

DYRK2 (DYRK2, Dual specificity tyrosine-phosphorylation-regulated kinase 2) (MaxLight 550)

Sign In for Pricing
View Details
Lentiviral human DNAJC24 shRNA (UAS) - Lentiviral human DNAJC24 shRNA (UAS, GFP) (25)
GTR15087452 1 Vial

Lentiviral human DNAJC24 shRNA (UAS) - Lentiviral human DNAJC24 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Lentiviral human CCT8 shRNA (UAS) - Lentiviral human CCT8 shRNA (UAS, iRFP) (25)
GTR15328277 1 Vial

Lentiviral human CCT8 shRNA (UAS) - Lentiviral human CCT8 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Lentiviral human AMIGO3 sgRNA gene knockout kit - Lentiviral human AMIGO3 sgRNA gene knockout kit (plasmid)
GTR15360296 1 Vial

Lentiviral human AMIGO3 sgRNA gene knockout kit - Lentiviral human AMIGO3 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Gal3st4 3'UTR Luciferase Stable Cell Line
TU106873 1.0 mL

Gal3st4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details