Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YIPF1 Rabbit Polyclonal Antibody (HRP)

YIPF1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FinGER1, DJ167A19.1

UniProt

Q9Y548

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VALATIVTIVLLHMLLSVGCLAYFFDAPEMDHLPTTTATPNQTVAAAKSS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061855

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-human amphiregulin polyclonal Antibody
MBS711699-01 0.1 mL

Rabbit anti-human amphiregulin polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human amphiregulin polyclonal Antibody
MBS711699-02 5x 0.1 mL

Rabbit anti-human amphiregulin polyclonal Antibody

Sign In for Pricing
View Details
NEDD1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2389932 100 µL

NEDD1 Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Paraffin Tissue Section - Human Tumor Cell Line: MCF-7
T2255830 5 Slides

Paraffin Tissue Section - Human Tumor Cell Line: MCF-7

Sign In for Pricing
View Details
ATPD Antibody
orb784914 2 mg

ATPD Antibody

Sign In for Pricing
View Details
Recombinant Populus euphratica Thioredoxin H-type
MBS1164283-01 0.05 mg (E-Coli)

Recombinant Populus euphratica Thioredoxin H-type

Sign In for Pricing
View Details