Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTULINL Rabbit Polyclonal Antibody (Biotin)

OTULINL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NET20, FAM105A

UniProt

Q9NUU6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM105A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HKLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061891

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TATA-box-binding protein-associated factor 11-like protein 7 (TFKL7), Biotinylated
orb3005424-01 20 µg

Recombinant Human TATA-box-binding protein-associated factor 11-like protein 7 (TFKL7), Biotinylated

Sign In for Pricing
View Details
Recombinant Human TATA-box-binding protein-associated factor 11-like protein 7 (TFKL7), Biotinylated
orb3005424-02 100 µg

Recombinant Human TATA-box-binding protein-associated factor 11-like protein 7 (TFKL7), Biotinylated

Sign In for Pricing
View Details
Recombinant Human TATA-box-binding protein-associated factor 11-like protein 7 (TFKL7), Biotinylated
orb3005424-03 1 mg

Recombinant Human TATA-box-binding protein-associated factor 11-like protein 7 (TFKL7), Biotinylated

Sign In for Pricing
View Details
AGR2 Antibody
orb1539202 50 µg

AGR2 Antibody

Sign In for Pricing
View Details
Herpes Simplex Virus I, II, Glycoprotein D (HSV I, II) (AP) discontinued
H2033-21E-AP 100 µL

Herpes Simplex Virus I, II, Glycoprotein D (HSV I, II) (AP) discontinued

Sign In for Pricing
View Details
HA1 (H7N9) (A/Shanghai/2/2013)
IT-003-0074p-01 0.1 mg

HA1 (H7N9) (A/Shanghai/2/2013)

Sign In for Pricing
View Details