Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTULINL Rabbit Polyclonal Antibody (FITC)

OTULINL Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NET20, FAM105A

UniProt

Q9NUU6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM105A

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HKLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061891

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cardiac Troponin I (TNNI3) Mouse Monoclonal Antibody [Clone ID: OTI8G8]
CF807946 100 µg

Cardiac Troponin I (TNNI3) Mouse Monoclonal Antibody [Clone ID: OTI8G8]

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary: right
CS505641 5x 5 µm

Frozen Tissue Sections, Ovary: right

Sign In for Pricing
View Details
Rat BAD (BCL-2 Associated Death Promoter) CLIA Kit
E-CL-R0071-01 24 Tests

Rat BAD (BCL-2 Associated Death Promoter) CLIA Kit

Sign In for Pricing
View Details
Rat BAD (BCL-2 Associated Death Promoter) CLIA Kit
E-CL-R0071-02 48 Tests

Rat BAD (BCL-2 Associated Death Promoter) CLIA Kit

Sign In for Pricing
View Details
Rat BAD (BCL-2 Associated Death Promoter) CLIA Kit
E-CL-R0071-03 96 Tests

Rat BAD (BCL-2 Associated Death Promoter) CLIA Kit

Sign In for Pricing
View Details
DKC1 (NM_001142463) Human Over-expression Lysate
LY428109 100 µg

DKC1 (NM_001142463) Human Over-expression Lysate

Sign In for Pricing
View Details