Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OTULINL Rabbit Polyclonal Antibody (HRP)

OTULINL Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NET20, FAM105A

UniProt

Q9NUU6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FAM105A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HKLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEE

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_061891

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ETNK2 Recombinant Protein
PROTQ9NVF9-50ug 50 µg

Human ETNK2 Recombinant Protein

Sign In for Pricing
View Details
Anti-FKBP52/FKBP4 Antibody Picoband® Fluoro647 Conjugated
A02165-3-Fluoro647 100 µg/Vial

Anti-FKBP52/FKBP4 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
TIF1-β (Phospho-Ser824) Polyclonal Conjugated Antibody
C12668 100 µL

TIF1-β (Phospho-Ser824) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
Human Eukaryotic peptide chain release factor subunit 1, ETF1 ELISA Kit
MBS9331407-01 48 Well

Human Eukaryotic peptide chain release factor subunit 1, ETF1 ELISA Kit

Sign In for Pricing
View Details
Human Eukaryotic peptide chain release factor subunit 1, ETF1 ELISA Kit
MBS9331407-02 96 Well

Human Eukaryotic peptide chain release factor subunit 1, ETF1 ELISA Kit

Sign In for Pricing
View Details
Human Eukaryotic peptide chain release factor subunit 1, ETF1 ELISA Kit
MBS9331407-03 5x 96 Well

Human Eukaryotic peptide chain release factor subunit 1, ETF1 ELISA Kit

Sign In for Pricing
View Details